Lolium rigidum (rigid ryegrass): 124674037 Help Entry 124674037         CDS       T09103                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03010   Ribosome lrd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     124674037   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124674037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:lrd03011]     124674037    04121 Ubiquitin system [BR:lrd04121]     124674037 Ribosome [BR:lrd03011]  Ribosomal proteins   Eukaryotes    Large subunit     124674037   Archaea     124674037 Ubiquitin system [BR:lrd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    124674037 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 UBL_UBAC1 Plexin_RBD TBK1_ULD Ubiquitin_5 Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  124674037 NCBI-ProteinID:  XP_047066030 LinkDB All DBs Position 7:7805053..7805286 Genome browser AA seq 77 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLRGGL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgaccggcaagaccatcaccctggaggtggagtcctct gacacgatcgacaacgttaaggcgaagatccaggacaaggagggcatcccgccggaccag cagcgcctcatcttcgccggcaagcagcttgaggatggccgcaccctcgccgactacaac atccagaaggagtccactctccaccttgtcctccgcctccgcggtggcctctaa

DBGET integrated database retrieval system