Lolium rigidum (rigid ryegrass): 124675810 Help Entry 124675810         CDS       T09103                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03010   Ribosome lrd04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     124675810   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124675810  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:lrd03011]     124675810    04121 Ubiquitin system [BR:lrd04121]     124675810 Ribosome [BR:lrd03011]  Ribosomal proteins   Eukaryotes    Large subunit     124675810   Archaea     124675810 Ubiquitin system [BR:lrd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    124675810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD UBL_UBAC1 Plexin_RBD DUF2604 Ubiquitin_5 Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  124675810 NCBI-ProteinID:  XP_047067841 LinkDB All DBs Position 7:complement(91343392..91343625) Genome browser AA seq 77 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLRGGL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaaaaccctgaccggcaagaccatcaccctagaggtggagtcctct gacacgatcgacaacgttaaggcgaagatccaggacaaggagggcatcccaccggaccag cagcgcctcatcttcgccggcaagcagcttgaggatggccgcaccctcgccgactacaac atccagaaggagtccactctccacctcgtcctccgactccgcggtggcctctaa

DBGET integrated database retrieval system