Lolium rigidum (rigid ryegrass): 124676563 Help Entry 124676563         CDS       T09103                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03018   RNA degradation lrd03040   Spliceosome Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     124676563   09123 Folding, sorting and degradation    03018 RNA degradation     124676563  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lrd03019]     124676563    03041 Spliceosome [BR:lrd03041]     124676563 Messenger RNA biogenesis [BR:lrd03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      124676563   mRNA degradation factors    5'-3' decay     Lsm complex      124676563 Spliceosome [BR:lrd03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     124676563 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  124676563 NCBI-ProteinID:  XP_047068560 LinkDB All DBs Position 7:complement(10052841..10055576) Genome browser AA seq 100 aa AA seqDB search MAGRKETALDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVESEREQDDPLKL TTKTRQLGLIVCRGTAVMLVSPTDGTDEIANPFLAADGAS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcggggcgcaaggagaccgcgcttgacctagccaagttcgtcgacaagggcgtccag gtcaagctcaccggcggccgccaagttactggaactttgaagggctatgaccagttgctg aacctagtgctggatgaagcagttgagtctgaaagagagcaagatgacccattgaaactg acaacgaagaccagacaacttggtctcatagtgtgtagaggtactgcagtcatgctggtg tcaccaactgatggaactgatgagattgccaacccttttcttgcagccgatggagcatca taa

DBGET integrated database retrieval system