Lolium rigidum (rigid ryegrass): 124681209 Help Entry 124681209         CDS       T09103                                  Name (RefSeq) rac-like GTP-binding protein 1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04145   Phagosome lrd04148   Efferocytosis lrd04517   IgSF CAM signaling lrd04518   Integrin signaling lrd04620   Toll-like receptor signaling pathway lrd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lrd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     124681209    04518 Integrin signaling     124681209  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124681209    04148 Efferocytosis     124681209  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124681209  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124681209  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124681209   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lrd04147]     124681209    04031 GTP-binding proteins [BR:lrd04031]     124681209 Membrane trafficking [BR:lrd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124681209  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124681209   Macropinocytosis    Ras GTPases     124681209  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124681209 Exosome [BR:lrd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124681209   Exosomal proteins of other body fluids (saliva and urine)    124681209   Exosomal proteins of colorectal cancer cells    124681209   Exosomal proteins of bladder cancer cells    124681209 GTP-binding proteins [BR:lrd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124681209 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  124681209 NCBI-ProteinID:  XP_047072106 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MNGGTSAVSRFIKCVAVGDGAVGKTCMLICYTCNKFPTDYIPTVFDNFSANVSVDGSIVN LGLWDTAGQEDYSRLRPLSYRGADVFILSFSLTSRASYENVHKKWMPELRRYAPGIPVLL VGTKLDLREDRAYLADHPTESIITAEQGEELRKQIGAVAYVECSSKTQRNIKAVFDTAIK AVLQPRRHKEIARKETRTGAGRSVRWYFCGRACLV NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgaacggcggaacatcggcggtgagccggttcatcaagtgcgtggcggtgggcgacggc gccgtgggcaagacctgcatgctcatctgctacacctgcaacaagttccccaccgactac atccccaccgtgttcgacaacttcagcgccaacgtatcggtggacgggagcatcgtcaac ctcggcctctgggacaccgctggtcaagaggactacagcaggctgaggcctctgagctac aggggagctgatgtcttcatcctctccttctccctcaccagcagagcaagctatgagaac gtgcacaagaagtggatgccggagcttcgccgctacgcgcccggcattcctgtacttctt gttggaaccaagttggatctccgagaagatagagcttatcttgctgatcatccaactgag tccattataacagctgagcagggagaggagctcaggaagcaaataggggcggtggcctac gtggaatgcagctccaagacacaaaggaacatcaaggctgttttcgacactgccatcaaa gcagttcttcaacctcggaggcacaaggagatagcccgcaaggaaactcggacaggagcc ggtcggtctgtaaggtggtacttttgcggaagagcttgtttggtgtaa

DBGET integrated database retrieval system