Lolium rigidum (rigid ryegrass): 124682234 Help Entry 124682234         CDS       T09103                                  Name (RefSeq) calmodulin-1   KO K02183   calmodulin Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04016   MAPK signaling pathway - plant lrd04070   Phosphatidylinositol signaling system lrd04075   Plant hormone signal transduction lrd04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:lrd00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     124682234    04070 Phosphatidylinositol signaling system     124682234    04075 Plant hormone signal transduction     124682234  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     124682234  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lrd01009]     124682234   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124682234    03036 Chromosome and associated proteins [BR:lrd03036]     124682234   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lrd04147]     124682234 Protein phosphatases and associated proteins [BR:lrd01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      124682234 Membrane trafficking [BR:lrd04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     124682234 Chromosome and associated proteins [BR:lrd03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      124682234 Exosome [BR:lrd04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    124682234 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  124682234 NCBI-ProteinID:  XP_047072918 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctattc gacaaggacggcgatggctgcatcacgaccaaggagctggggacggtcatgcgttcgctg gggcagaacccaaccgaggcggagctccaggacatgatcaacgaggttgatgctgacggc aacggcaccatcgactttcccgagttcctcaacctgatggctcgcaagatgaaggacacc gactcggaagaggagctcaaggaggccttccgggtgttcgacaaggaccagaacggcttc atctcggccgcggagctccgccacgtcatgaccaacctcggcgagaagctaacggacgaa gaggttgacgagatgatccgtgaggccgacgtggacggtgatggccagatcaactacgag gagttcgtcaaggtgatgatggccaagtga

DBGET integrated database retrieval system