Lolium rigidum (rigid ryegrass): 124687645 Help Entry 124687645         CDS       T09103                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism lrd  Lolium rigidum (rigid ryegrass) Brite KEGG Orthology (KO) [BR:lrd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:lrd03041]     124687645   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lrd04052]     124687645 Spliceosome [BR:lrd03041]  Complex B   Other components    Complex B specific factors     124687645 Cytokines and neuropeptides [BR:lrd04052]  Neuropeptides   Unclassified    124687645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  124687645 NCBI-ProteinID:  XP_047077368 LinkDB All DBs Position 2:166089662..166090230 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNVYKDHITLADY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctgaacgaccggctggggaagaaggtgcgcgtcaagtgcaacgag gacgacacgatcggcgacctgaagaagctggtggcggcgcagacggggacgcgcgccgac aagatccgcatccagaagtggtacaacgtctacaaggaccacatcaccctcgccgactac gagatccacgacggcatgggcctcgagctatactacaactag

DBGET integrated database retrieval system