Lolium rigidum (rigid ryegrass): 124691291
Help
Entry
124691291 CDS
T09103
Name
(RefSeq) SKP1-like protein 4
KO
K03094
S-phase kinase-associated protein 1
Organism
lrd
Lolium rigidum (rigid ryegrass)
Pathway
lrd03083
Polycomb repressive complex
lrd04120
Ubiquitin mediated proteolysis
lrd04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
lrd00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
124691291
04120 Ubiquitin mediated proteolysis
124691291
09126 Chromosome
03083 Polycomb repressive complex
124691291
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
lrd04131
]
124691291
04121 Ubiquitin system [BR:
lrd04121
]
124691291
03036 Chromosome and associated proteins [BR:
lrd03036
]
124691291
Membrane trafficking [BR:
lrd04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
124691291
Ubiquitin system [BR:
lrd04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
124691291
Cul7 complex
124691291
Chromosome and associated proteins [BR:
lrd03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
124691291
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
124691291
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
124691291
NCBI-ProteinID:
XP_047080521
LinkDB
All DBs
Position
2:complement(89672093..89672599)
Genome browser
AA seq
168 aa
AA seq
DB search
MATSSSSAAKTVTLRSSDGEEFVVKADTFASASVLVRNMLEDDCAGGAIPLTQVTGRILS
RVIDYCDHHYADADAATYVAEPFFSGDSDLERFDTDFIGGIDLDTLIDLILAANYLEVPR
LLDLACKTVADQMRGKTVEEMRAHFKIANDYTPEEEAEVRSENPWAFE
NT seq
507 nt
NT seq
+upstream
nt +downstream
nt
atggcgactagcagcagcagcgccgccaagactgtgacgctccgcagctccgacggcgag
gagttcgtggtcaaggcggacacgttcgcgtcggcgtcggtgctggtccggaacatgctg
gaggacgactgcgccggcggcgcgattccgctgacccaggtcaccggccgcatcctctcc
cgcgtcatcgactactgcgaccaccactacgccgacgccgacgcggccacctacgtcgcg
gagcccttcttctcgggcgactccgacctggagcgcttcgacacggacttcatcggcggc
atcgacttagacacgctcatcgacctcatcctcgccgccaactaccttgaagtgccgcgg
ctcctggacctggcctgcaagacggtggccgaccagatgaggggcaagaccgtggaggag
atgcgcgcgcacttcaagatcgccaacgactacaccccggaggaggaggccgaggtccgc
tccgagaacccatgggccttcgagtag
DBGET
integrated database retrieval system