Lolium rigidum (rigid ryegrass): 124693109 Help Entry 124693109         CDS       T09103                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04145   Phagosome lrd04148   Efferocytosis lrd04620   Toll-like receptor signaling pathway lrd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lrd00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124693109    04148 Efferocytosis     124693109  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124693109  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124693109  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124693109   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lrd04147]     124693109    04031 GTP-binding proteins [BR:lrd04031]     124693109 Membrane trafficking [BR:lrd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124693109  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124693109   Macropinocytosis    Ras GTPases     124693109  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124693109 Exosome [BR:lrd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124693109   Exosomal proteins of other body fluids (saliva and urine)    124693109   Exosomal proteins of colorectal cancer cells    124693109   Exosomal proteins of bladder cancer cells    124693109 GTP-binding proteins [BR:lrd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124693109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C Gtr1_RagA Motif Other DBs NCBI-GeneID:  124693109 NCBI-ProteinID:  XP_047082519 LinkDB All DBs Position 2:complement(232330586..232333221) Genome browser AA seq 201 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLVGT KLDLREDKHYLMDHPGMIPVTTAQGEELRKQVGALYYVECSSKTQQNVKAVFDAAIKVVI QPPSKQREKKKKKQRRGCSMM NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcttcgcggttcatcaagtgcgtcacggtcggcgacggcgccgtcggc aagacctgcatgctcatctgctacaccagcaacaagttccccaccgactacatacctacg gtgttcgacaatttcagcgcaaacgtagttgtggacggcaccacggtgaatttgggcctt tgggacactgcagggcaggaggattacaaccggctgaggcctctaagctaccgtggagct gatgttttcgtgcttgctttctcgcttgtgagccgagctagctatgagaatattatgaag aagtggataccggagcttcagcattacgcgcctggcgtgccagttgtgttggtaggcaca aaactagatcttcgtgaagacaagcactacttgatggaccatcctggcatgatacccgtt accacagcacagggagaggagcttcggaaacaagttggtgcattatattacgtagagtgc agctcaaagacacagcagaatgtcaaagctgtctttgatgctgctatcaaggtggtaatc cagcccccaagtaagcaaagagaaaagaagaaaaagaaacaacgacggggatgttctatg atgtaa

DBGET integrated database retrieval system