KEGG   Lolium rigidum (rigid ryegrass): 124698602
Entry
124698602         CDS       T09103                                 
Name
(RefSeq) mitochondrial import inner membrane translocase subunit TIM17-2-like
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
lrd  Lolium rigidum (rigid ryegrass)
Brite
KEGG Orthology (KO) [BR:lrd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lrd03029]
    124698602
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lrd02000]
    124698602
Mitochondrial biogenesis [BR:lrd03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    124698602
Transporters [BR:lrd02000]
 Other transporters
  Primary active transporters [TC:3]
   124698602
SSDB
Motif
Pfam: Tim17 DUF2076
Other DBs
NCBI-GeneID: 124698602
NCBI-ProteinID: XP_047087041
LinkDB
Position
3:166742096..166742782
AA seq 208 aa
MGVVGGSIFHYMKGMYNSPNGYRLSGGVQAMRMNAPRVGGSFAAWGCLFSTFDCAMVYAR
QKEDPWNSIAAGAAAGGFLAMRGGLFASARSAMVGGALLALIEGAGIMLNRVLVEVPPPP
PPPGMDPAEVPGQGQGPPPPIGFTFPGMPQPRPVVVDEVPVTGSGGSGGWLGGLFGKKKD
DKVAGDRKSEVLESFDTPSPPMPSFDYK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgggcgtggtggggggctccatcttccactacatgaagggcatgtacaactccccgaac
ggctaccgcttgtccggcggggtccaggccatgcgcatgaacgctccgcgcgtcggcggg
agcttcgccgcgtggggctgcctcttctccacgttcgactgcgccatggtctacgcgcgc
cagaaggaggacccctggaactctatcgccgccggcgccgcagccggcggtttccttgcc
atgcggggcggcctctttgcttctgccagatccgcaatggtcggcggcgccctcctcgct
ctcatcgagggcgcgggcatcatgctgaaccgcgtgttggtggaagttccgccgccgccg
ccgccccctggcatggatccggccgaggtaccagggcaagggcaagggccaccaccgccc
attggattcactttccctgggatgccgcagcctcggccggttgtggtcgatgaggtcccg
gtaactggatccgggggctctggtggatggctggggggcttgtttggtaagaagaaggac
gataaggtggctggtgatcgcaagtcggaggtgttggagagcttcgatacgcccagcccg
ccaatgccatccttcgactacaagtga

DBGET integrated database retrieval system