Lolium rigidum (rigid ryegrass): 124700249 Help Entry 124700249         CDS       T09103                                  Name (RefSeq) SKP1-like protein 1 isoform X1   KO K03094   S-phase kinase-associated protein 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03083   Polycomb repressive complex lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124700249    04120 Ubiquitin mediated proteolysis     124700249   09126 Chromosome    03083 Polycomb repressive complex     124700249  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124700249    04121 Ubiquitin system [BR:lrd04121]     124700249    03036 Chromosome and associated proteins [BR:lrd03036]     124700249 Membrane trafficking [BR:lrd04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     124700249 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      124700249    Cul7 complex      124700249 Chromosome and associated proteins [BR:lrd03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      124700249   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      124700249 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Motif Other DBs NCBI-GeneID:  124700249 NCBI-ProteinID:  XP_047088362 LinkDB All DBs Position 3:348444983..348446536 Genome browser AA seq 164 aa AA seqDB search MAAEDPKKMITLKSNDGEEFEVEEAVAMGSQTIRHMIEDDCADNGIPLPNVNSKILSKVI EYCKKHVQLAAKPVADGASALSSTEDIKNWEAEFVNVDKATLFDLSLAANYLNIKGLLDL TCQTIADMIKGMTPEEIRKTFNIKNDFTAEEEEAVRRENQWAFE NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atggcggccgaggacccaaagaagatgatcacgctcaagtccaacgacggggaggagttc gaggtggaggaggcggtggcgatggggtcgcagacgatccgccacatgatcgaggacgac tgcgccgacaacgggatcccgctccccaacgtcaactccaagatcctctccaaggtaatt gagtattgcaaaaagcacgtccagctggcggccaagcccgtggccgatggcgcttctgcc ctgtcctccacggaggacatcaagaattgggaggccgagttcgtcaacgtcgacaaggcc accctctttgaccttagcctcgccgccaactacctcaacatcaaggggctgctggacctc acctgccagaccatcgccgacatgatcaagggcatgactccggaggagatccgcaagacc ttcaacatcaagaacgacttcaccgctgaggaggaggaggcggtccgcagggagaaccag tgggcctttgagtaa

DBGET integrated database retrieval system