Lolium rigidum (rigid ryegrass): 124703215 Help Entry 124703215         CDS       T09103                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism lrd  Lolium rigidum (rigid ryegrass) Brite KEGG Orthology (KO) [BR:lrd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:lrd03041]     124703215   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lrd04052]     124703215 Spliceosome [BR:lrd03041]  Complex B   Other components    Complex B specific factors     124703215 Cytokines and neuropeptides [BR:lrd04052]  Neuropeptides   Unclassified    124703215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  124703215 NCBI-ProteinID:  XP_047091397 LinkDB All DBs Position 3:242332824..242334793 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYTIYKDHITLGDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctcaacgaccgtctggggaagaaggtgcgcgtcaagtgcaacgag gacgacaccatcggcgacctcaagaagctcgtggcggcgcagaccgggaccaggcccgag aagatccgcatccagaagtggtacaccatctacaaggaccacatcaccctcggcgactac gagatccacgacggaatgggactcgagctctactacaactag

DBGET integrated database retrieval system