Lacticaseibacillus rhamnosus GG: LRHM_1594 Help Entry LRHM_1594         CDS       T02100                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lrg  Lacticaseibacillus rhamnosus GG Pathway lrg01100   Metabolic pathways lrg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lrg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LRHM_1594    00074 Mycolic acid biosynthesis     LRHM_1594   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LRHM_1594 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 TerB Motif Other DBs NCBI-ProteinID:  BAI42121 UniProt:  A0A7S7JHF6 LinkDB All DBs Position complement(1680275..1680517) Genome browser AA seq 80 aa AA seqDB search MSEDEIYQKIAGLIQDHFQLSPDKISPSLNFKEDLDADSIDIVEFVLELEDAFGSEIPDD DAENIKTVQDAVDYIKAHQK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagtgaagacgaaatttatcaaaagattgccggcttgattcaggatcactttcaacta agtcctgataagatcagcccgagtttgaactttaaagaagatcttgatgcagattcgatt gacattgtggaattcgttttggaactagaggatgcctttggttcagaaattccggatgac gatgcagaaaatatcaagacagttcaagatgccgtcgattatatcaaggcacatcaaaaa taa

DBGET integrated database retrieval system