Lacticaseibacillus rhamnosus GG: LRHM_1609 Help Entry LRHM_1609         CDS       T02100                                  Name (GenBank) RNA polymerase omega subunit   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism lrg  Lacticaseibacillus rhamnosus GG Pathway lrg03020   RNA polymerase Brite KEGG Orthology (KO) [BR:lrg00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     LRHM_1609  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:lrg03021]     LRHM_1609    03400 DNA repair and recombination proteins [BR:lrg03400]     LRHM_1609 Enzymes [BR:lrg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      LRHM_1609 Transcription machinery [BR:lrg03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      LRHM_1609 DNA repair and recombination proteins [BR:lrg03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       LRHM_1609 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 DUF5397 Motif Other DBs NCBI-ProteinID:  BAI42136 UniProt:  A0A7S7JHG1 LinkDB All DBs Position complement(1697585..1697827) Genome browser AA seq 80 aa AA seqDB search MIIYPSIDKLLEKVPSRYSLAVLAAKRAHELEAGDLKMLSDYKSDKSVGKALEEIAAGDV IIDPKSKMLERDAEKLDHKD NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgattatttatccttcaattgacaagttattggaaaaggtgccctcacgttattcactt gctgttttagcagccaagcgtgcacacgaacttgaagcgggcgatttgaaaatgttgtcc gactataaatcagataagagtgtcggcaaagcgcttgaagaaattgctgctggcgacgtg attattgatccaaaatcaaagatgcttgaacgggatgccgaaaaactcgatcacaaagat taa

DBGET integrated database retrieval system