KEGG   Lethenteron reissneri (Far Eastern brook lamprey): 133359039
Entry
133359039         CDS       T09663                                 
Name
(RefSeq) GTP-binding protein Di-Ras2-like
  KO
K07841  DIRAS family, GTP-binding Ras-like 2
Organism
lrj  Lethenteron reissneri (Far Eastern brook lamprey)
Brite
KEGG Orthology (KO) [BR:lrj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:lrj04031]
    133359039
GTP-binding proteins [BR:lrj04031]
 Small (monomeric) G-proteins
  Ras Family
   Di-Ras [OT]
    133359039
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 AAA_16 RsgA_GTPase AAA_24 nSTAND1
Other DBs
NCBI-GeneID: 133359039
NCBI-ProteinID: XP_061433392
LinkDB
Position
64:10862392..10896889
AA seq 198 aa
MPEQSNDYRVVVFGAGGVGKSSLVLRFVRGTFREAYVPTIEDTYRQVISCDKSVCTLQIT
DTTGSHQFPAMQRLAISRGHAFLLVYAVTSRQSLEELRPIYDVIVQIKGDISAVPMMLVA
NKCDETAREVPAGEGEAQAKAWRCAFTETSAKMDYNVTEAFQELLNLEKRRHMSLQVDGN
KGGKQSSRKHFKGKCVVM
NT seq 597 nt   +upstreamnt  +downstreamnt
atgccggagcagagcaacgactaccgcgtggtggtgttcggcgcgggcggcgtcggcaag
agctcgctggtgctgcgcttcgtgaggggcaccttccgcgaggcctacgtgcccaccatc
gaggacacctaccgccaggtgatcagctgcgacaagagcgtgtgcacgctgcagatcacc
gacacgacgggctcgcaccagttccccgccatgcagcggctggcgatctcgcgcggccat
gccttcctgctcgtctacgcggtgacgagccggcagagcttggaggaactgcggcccatc
tacgacgtcatcgtgcagatcaaaggcgacatctccgccgtgcccatgatgctcgtggcc
aacaagtgcgacgagacggcgcgcgaggtgcccgccggcgagggggaggcgcaggccaag
gcgtggcgctgcgccttcaccgagacgtcggccaagatggactacaacgtcaccgaggcc
ttccaggagctgctcaacctggagaagaggcggcacatgagcctgcaggtggatgggaac
aaaggtggaaagcaatcttcccggaagcacttcaagggcaagtgcgtggtcatgtga

DBGET integrated database retrieval system