Labeo rohita (rohu): 127152370 Help Entry 127152370         CDS       T09007                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism lroh  Labeo rohita (rohu) Pathway lroh04814   Motor proteins lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     127152370 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127152370 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lroh03037]     127152370 (dynll2b)    04812 Cytoskeleton proteins [BR:lroh04812]     127152370 (dynll2b) Cilium and associated proteins [BR:lroh03037]  Motile cilia and associated proteins   Dynein arm    127152370 (dynll2b) Cytoskeleton proteins [BR:lroh04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127152370 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  127152370 NCBI-ProteinID:  XP_050948947 LinkDB All DBs Position 21:5582888..5589641 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaataaagaacgctgatatgtctgaggacatgcagcaggat gcagtggattgtgccacacaggccatggagaagtacaacattgagaaggacattgctgcg tatatcaaaaaggagttcgataagaagtataatccgacatggcattgtattgtgggacgg aactttggcagttatgtgacgcatgaaactaagcatttcatctacttttacttgggtcaa gtggccattctgctcttcaaatcgggctga

DBGET integrated database retrieval system