Labeo rohita (rohu): 127153230 Help Entry 127153230         CDS       T09007                                  Symbol dnal4b Name (RefSeq) dynein, axonemal, light chain 4b   KO K10412   dynein axonemal light chain 4 Organism lroh  Labeo rohita (rohu) Pathway lroh04814   Motor proteins Brite KEGG Orthology (KO) [BR:lroh00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     127153230 (dnal4b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lroh03037]     127153230 (dnal4b)    04812 Cytoskeleton proteins [BR:lroh04812]     127153230 (dnal4b) Cilium and associated proteins [BR:lroh03037]  Motile cilia and associated proteins   Dynein arm    127153230 (dnal4b) Cytoskeleton proteins [BR:lroh04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127153230 (dnal4b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  127153230 NCBI-ProteinID:  XP_050950161 LinkDB All DBs Position 22:24959789..24961828 Genome browser AA seq 106 aa AA seqDB search MAETVDGKKDEADYKRLHSFPLIRHTDMSEEMRVETMELCVTACEKFATNNESAAKMIKE SMDKKFGSSWHVVIGEGFGFEITHEVKNLLYMFFGGGLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagagacagtcgatggcaagaaggacgaggcagactataagagactacacagcttt cctctcatacggcacacagatatgtctgaggagatgcgggtggagactatggagctctgc gttacggcgtgtgagaagtttgccactaataatgagagtgctgctaaaatgataaaggag tcaatggataagaagtttgggagctcttggcatgtggtgattggcgagggcttcggtttc gaaattacgcacgaagtgaagaacctgctttacatgttcttcggtggaggtttggcagtt tgcgtatggaagtgttcctaa

DBGET integrated database retrieval system