Labeo rohita (rohu): 127155966 Help Entry 127155966         CDS       T09007                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism lroh  Labeo rohita (rohu) Brite KEGG Orthology (KO) [BR:lroh00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:lroh01002]     127155966   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127155966 Peptidases and inhibitors [BR:lroh01002]  Peptidase inhibitors   Family I25: cystatin family    127155966 Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127155966 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  127155966 NCBI-ProteinID:  XP_050954557 LinkDB All DBs Position 24:complement(14140480..14141459) Genome browser AA seq 100 aa AA seqDB search MEGCCGGLSEAEDAIKEVQKICDEMKSHAEDKAGRKFDVFIAKSYKTQVVAGRNYFVKVH VGGDEYIHLRVYKKLPCYGATLELTDIQTSKAHHDPIEYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggaagggtgttgtggcggactatctgaggcggaagatgccattaaagaggtgcagaaa atatgcgatgagatgaagtctcacgccgaggataaagctgggcgcaagtttgacgttttc atcgccaaatcttataaaacacaagttgttgcggggagaaattacttcgttaaggtgcat gtaggaggggatgagtacattcatttacgtgtctataaaaaactgccctgttatggagca acactggagctgaccgacatacagacatccaaggctcatcatgatcctattgaatacttc tga

DBGET integrated database retrieval system