Labeo rohita (rohu): 127156886 Help Entry 127156886         CDS       T09007                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism lroh  Labeo rohita (rohu) Pathway lroh03082   ATP-dependent chromatin remodeling lroh04217   Necroptosis Brite KEGG Orthology (KO) [BR:lroh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     127156886  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127156886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lroh03036]     127156886   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127156886 Chromosome and associated proteins [BR:lroh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127156886 Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127156886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  127156886 NCBI-ProteinID:  XP_050955977 LinkDB All DBs Position 25:3720726..3720992 Genome browser AA seq 88 aa AA seqDB search MTHHCNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPHHLQLVVRNDEE LNKLLGGVTIAQGGVLLPKKTDKAAETK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacccatcactgcaactatgccgagcgcgtcggtgctggtgctcccgtttatttggcc gctgtgctcgagtatctcactgctgagatcttggagctggctggaaacgccgctcgggac aacaagaagacccgtatcatccctcatcacctgcagctggtggtgcgcaatgacgaagag ctgaacaaactcctgggtggcgtgaccatcgctcagggtggtgtgctgctgcccaagaaa actgacaaggccgccgaaaccaagtaa

DBGET integrated database retrieval system