Labeo rohita (rohu): 127164789 Help Entry 127164789         CDS       T09007                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism lroh  Labeo rohita (rohu) Pathway lroh03030   DNA replication lroh03082   ATP-dependent chromatin remodeling lroh03410   Base excision repair lroh03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:lroh00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     127164789 (pole3)    03410 Base excision repair     127164789 (pole3)    03420 Nucleotide excision repair     127164789 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     127164789 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lroh03032]     127164789 (pole3)    03036 Chromosome and associated proteins [BR:lroh03036]     127164789 (pole3)    03400 DNA repair and recombination proteins [BR:lroh03400]     127164789 (pole3) Enzymes [BR:lroh01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      127164789 (pole3) DNA replication proteins [BR:lroh03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     127164789 (pole3) Chromosome and associated proteins [BR:lroh03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     127164789 (pole3) DNA repair and recombination proteins [BR:lroh03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       127164789 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 CIS_TMP DUF4746 PPP4R2 Bromo_TP RNA_pol_3_Rpc31 CDC45 NOA36 Motif Other DBs NCBI-GeneID:  127164789 NCBI-ProteinID:  XP_050964822 LinkDB All DBs Position 5:26550058..26552325 Genome browser AA seq 148 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVMSAMEEMEFERFLQPLREALEAYKKGQKGKKEASEQKRKDKEKKNSTDEND KSRDEEEDEHMDDEQEGENEGEEEDVEN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctgagagaccagaggacctcaatcttcccaatgctgtcatcacgaggattataaaa gaggcattgccagacggagttaacgtgtctaaggaagcaagaagagccatatctcaagca gccagtgttttcgttctctatgcaacatcttgtgcaaacaattttgctatgaaagcaaag aggaagacactcaatgctggagatgtgatgtcagctatggaggagatggagtttgagcgt ttcttgcaacccttgcgggaagcacttgaagcctacaagaaaggtcaaaaaggcaagaag gaggcatctgagcaaaaacgtaaggacaaggagaagaagaacagcacagatgagaatgac aagagcagagatgaagaggaagacgagcatatggatgatgagcaggagggagagaatgaa ggagaggaggaggatgtggagaactga

DBGET integrated database retrieval system