Labeo rohita (rohu): 127165480 Help Entry 127165480         CDS       T09007                                  Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism lroh  Labeo rohita (rohu) Brite KEGG Orthology (KO) [BR:lroh00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:lroh01002]     127165480   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127165480 Peptidases and inhibitors [BR:lroh01002]  Peptidase inhibitors   Family I25: cystatin family    127165480 Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127165480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  127165480 NCBI-ProteinID:  XP_050966104 LinkDB All DBs Position 5:43722937..43723924 Genome browser AA seq 95 aa AA seqDB search MSDWSPVTPVTPEVNSICLQVKPQVVSMAGANFAVYTPLDFISKNEAGVNYTYIVKVSVE KDKCVHAKISQAGEGQLNLEAIRYPKNMDDPLVPF NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtctgactggagcccggtgacgcctgtcactccagaggtgaacagcatctgccttcag gtaaagccacaagtggtgagcatggctggagccaattttgcggtttacactcctctggac tttatttctaaaaatgaggctggagtaaactacacatacatagtaaaggtgagtgttgaa aaagacaagtgtgttcatgcaaagatatcacaggccggtgaaggacaactgaatttggaa gcaatccgctacccaaaaaacatggatgaccctctggtccccttctga

DBGET integrated database retrieval system