Labeo rohita (rohu): 127165543 Help Entry 127165543         CDS       T09007                                  Symbol myl2a Name (RefSeq) myosin regulatory light chain 2a   KO K10351   myosin regulatory light chain 2 Organism lroh  Labeo rohita (rohu) Pathway lroh04260   Cardiac muscle contraction lroh04261   Adrenergic signaling in cardiomyocytes lroh04371   Apelin signaling pathway lroh04510   Focal adhesion lroh04520   Adherens junction lroh04530   Tight junction lroh04810   Regulation of actin cytoskeleton lroh04814   Motor proteins lroh04820   Cytoskeleton in muscle cells lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     127165543 (myl2a)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     127165543 (myl2a)    04520 Adherens junction     127165543 (myl2a)    04530 Tight junction     127165543 (myl2a)   09142 Cell motility    04814 Motor proteins     127165543 (myl2a)    04820 Cytoskeleton in muscle cells     127165543 (myl2a)    04810 Regulation of actin cytoskeleton     127165543 (myl2a)  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     127165543 (myl2a)    04261 Adrenergic signaling in cardiomyocytes     127165543 (myl2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127165543 (myl2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lroh04812]     127165543 (myl2a) Cytoskeleton proteins [BR:lroh04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      127165543 (myl2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 Motif Other DBs NCBI-GeneID:  127165543 NCBI-ProteinID:  XP_050966227 LinkDB All DBs Position 5:complement(45552706..45559317) Genome browser AA seq 169 aa AA seqDB search MAPKKAKKRAAEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRL NVKQEEIDDMLKEASGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGILKKEYV TEMLTTQADRFSAEEMEQMFTAFPPDAAGNLDYRNLVHIITHGEEKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcaccaaagaaagcaaagaagagggcggccgaaggagcgaactccaacgtcttctcc atgtttgaacaggctcagatccaggagttcaaggaggcatttaccatcatggaccagaac agagacggattcattgacaagaatgacctgagggacacgtttgcagctctagggcggctc aatgtgaagcaggaggagattgatgacatgctgaaggaggcgtcgggtccgatcaacttc accgtcttcctcaccatgttcggagagaaactcaaaggagccgatccagaggaaaccatc ctcaacgccttcaaagtgtttgatccagaggggaagggaatcctcaagaaggaatatgtt actgagatgttgaccacgcaggcggaccggttttctgcagaggagatggagcagatgttc accgcattccctccagacgctgcgggaaacctggactaccggaatctggtccacatcatc actcacggagaggagaaggaccaggaatag

DBGET integrated database retrieval system