Labeo rohita (rohu): 127166810 Help Entry 127166810         CDS       T09007                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism lroh  Labeo rohita (rohu) Pathway lroh04144   Endocytosis lroh04150   mTOR signaling pathway lroh04270   Vascular smooth muscle contraction lroh04310   Wnt signaling pathway lroh04350   TGF-beta signaling pathway lroh04510   Focal adhesion lroh04520   Adherens junction lroh04530   Tight junction lroh04621   NOD-like receptor signaling pathway lroh04625   C-type lectin receptor signaling pathway lroh04810   Regulation of actin cytoskeleton lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     127166810 (rhoca)    04350 TGF-beta signaling pathway     127166810 (rhoca)    04150 mTOR signaling pathway     127166810 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127166810 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     127166810 (rhoca)    04520 Adherens junction     127166810 (rhoca)    04530 Tight junction     127166810 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     127166810 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     127166810 (rhoca)    04625 C-type lectin receptor signaling pathway     127166810 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     127166810 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127166810 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lroh04131]     127166810 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127166810 (rhoca)    04031 GTP-binding proteins [BR:lroh04031]     127166810 (rhoca) Membrane trafficking [BR:lroh04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     127166810 (rhoca) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127166810 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    127166810 (rhoca)   Exosomal proteins of colorectal cancer cells    127166810 (rhoca)   Exosomal proteins of bladder cancer cells    127166810 (rhoca) GTP-binding proteins [BR:lroh04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     127166810 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  127166810 NCBI-ProteinID:  XP_050968339 LinkDB All DBs Position 6:complement(29656142..29671170) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELTKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQ VRKRKKRSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcggctatcaggaaaaagctggtgatcgtgggagatggagcatgtgggaagacctgt ctcctcatagtgttcagcaaagaccagtttccagaagtctacgtgcctactgtgtttgag aactacattgcagacatcgaagtcgacagcaaacaggtggagctggctttgtgggacaca gcaggacaggaagactatgatcgtctgaggcctctgtcttacccagacacagatgtcatc ctcatgtgtttctccatagacagtcccgacagtttagagaatatcccagaaaagtggacg ccggaggtgaagcacttctgccccaacgttcccataatccttgtgggcaataagaaggac ctgcggaatgatgagcacacacggagagagctgactaagatgaagcaggagccggttaaa ccggaggaaggcagggacatggccaaccgcatcagcgccttcggctacctggagtgctcg gctaagactaaagaaggcgtgagggaagttttcgaaatggccaccagggcggcgctgcaa gtccgcaagaggaagaagaggagcgggtgcttgctgttgtga

DBGET integrated database retrieval system