Labeo rohita (rohu): 127167436 Help Entry 127167436         CDS       T09007                                  Symbol cxcl8a Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism lroh  Labeo rohita (rohu) Pathway lroh04060   Cytokine-cytokine receptor interaction lroh04218   Cellular senescence lroh04620   Toll-like receptor signaling pathway lroh04621   NOD-like receptor signaling pathway lroh04622   RIG-I-like receptor signaling pathway lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127167436 (cxcl8a)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     127167436 (cxcl8a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127167436 (cxcl8a)    04621 NOD-like receptor signaling pathway     127167436 (cxcl8a)    04622 RIG-I-like receptor signaling pathway     127167436 (cxcl8a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127167436 (cxcl8a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lroh04052]     127167436 (cxcl8a)    00536 Glycosaminoglycan binding proteins [BR:lroh00536]     127167436 (cxcl8a) Cytokines and neuropeptides [BR:lroh04052]  Cytokines   Chemokines    127167436 (cxcl8a) Glycosaminoglycan binding proteins [BR:lroh00536]  Heparan sulfate / Heparin   Chemokines    127167436 (cxcl8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  127167436 NCBI-ProteinID:  XP_050969455 LinkDB All DBs Position 1:complement(39645202..39646448) Genome browser AA seq 98 aa AA seqDB search MHCKIILVSVIVFLGFLSIGEGMSLRGLGVDPRCRCIETESRRIGKLIESVELFPPSPHC KDTEIIATLKGSGKEICLDPTAPWVKKVIEKIIANKAP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcactgcaaaatcattttagtctctgttattgttttccttggattcctgagcattggt gaaggaatgagtcttagaggtctgggtgtagatccacgctgtcgctgcattgaaacagag agccgtcgcattggaaaactcatagagagtgtggagctcttccctccaagcccacactgt aaagacacagagatcattgccactctgaagggatctgggaaagagatctgtctggaccct actgcaccctgggttaagaaggtcattgagaaaatcattgccaacaaagcaccatga

DBGET integrated database retrieval system