Labeo rohita (rohu): 127167847 Help Entry 127167847         CDS       T09007                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism lroh  Labeo rohita (rohu) Pathway lroh03082   ATP-dependent chromatin remodeling lroh04217   Necroptosis Brite KEGG Orthology (KO) [BR:lroh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     127167847  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127167847  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lroh03036]     127167847   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127167847 Chromosome and associated proteins [BR:lroh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127167847 Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127167847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  127167847 NCBI-ProteinID:  XP_050970092 LinkDB All DBs Position 7:46476233..46476864 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYGERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TDKPAKTN NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggaagaggcaaaaccggtggaaaagcccgcgctaaggctaagagtcgctcttcc agggctggattgcagtttcccgtcggtcgtgttcacaggcttcttcgaaaaggcaactac ggcgagcgcgttggtgctggtgctccagtttatttggccgctgtactcgagtatctcact gctgagattctggagttggctggaaacgccgctcgggacaacaagaaaacccgtatcatt ccccgccatctgcagctggcggtgcgtaatgatgaagagctgaacaagcttttgggtggc gtgaccatcgctcagggcggtgtgttgcccaacattcaggctgtgctgttgcccaagaaa accgacaagccagccaaaaccaactaa

DBGET integrated database retrieval system