Labeo rohita (rohu): 127168650 Help Entry 127168650         CDS       T09007                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism lroh  Labeo rohita (rohu) Pathway lroh04010   MAPK signaling pathway lroh04012   ErbB signaling pathway lroh04068   FoxO signaling pathway lroh04137   Mitophagy - animal lroh04140   Autophagy - animal lroh04144   Endocytosis lroh04150   mTOR signaling pathway lroh04210   Apoptosis lroh04218   Cellular senescence lroh04370   VEGF signaling pathway lroh04371   Apelin signaling pathway lroh04510   Focal adhesion lroh04540   Gap junction lroh04625   C-type lectin receptor signaling pathway lroh04810   Regulation of actin cytoskeleton lroh04910   Insulin signaling pathway lroh04912   GnRH signaling pathway lroh04916   Melanogenesis lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127168650 (hrasb)    04012 ErbB signaling pathway     127168650 (hrasb)    04370 VEGF signaling pathway     127168650 (hrasb)    04371 Apelin signaling pathway     127168650 (hrasb)    04068 FoxO signaling pathway     127168650 (hrasb)    04150 mTOR signaling pathway     127168650 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127168650 (hrasb)    04140 Autophagy - animal     127168650 (hrasb)    04137 Mitophagy - animal     127168650 (hrasb)   09143 Cell growth and death    04210 Apoptosis     127168650 (hrasb)    04218 Cellular senescence     127168650 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     127168650 (hrasb)    04540 Gap junction     127168650 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     127168650 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127168650 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     127168650 (hrasb)    04912 GnRH signaling pathway     127168650 (hrasb)    04916 Melanogenesis     127168650 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127168650 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lroh04131]     127168650 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127168650 (hrasb)    04031 GTP-binding proteins [BR:lroh04031]     127168650 (hrasb) Membrane trafficking [BR:lroh04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127168650 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     127168650 (hrasb) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127168650 (hrasb)   Exosomal proteins of colorectal cancer cells    127168650 (hrasb) GTP-binding proteins [BR:lroh04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127168650 (hrasb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  127168650 NCBI-ProteinID:  XP_050971623 LinkDB All DBs Position 7:18690094..18697553 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQG CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagttagtggtggttggcgcaggtggtgttggcaagagcgctctgacc atccagctcattcagaaccactttgtggatgaatacgacccaaccattgaggactcatat aggaaacaggtggtgattgatggagagacgtgtctgttggatatcctggatactgcaggt caggaagagtacagtgcaatgagggaccagtatatgaggactggagagggctttctctgt gtctttgccatcaacaataccaagtcttttgaggacattcatcagtacagagaacagata aagagggtcaaagactcagatgatgtgcctatggtgctcgtgggtaataaatgtgaccta ccagcacgcactgtggacacaaggcaagcccaggaactcgcccgtagctacggtattccc tacattgaaacctcagccaagacaagacagggagtggaagatgccttttacactcttgtc cgtgaaatcagacagcataagctgaggaaactgaacccgccggatgacaatggccaaggc tgtatgaactgccgctgtgtggtgtcatga

DBGET integrated database retrieval system