Labeo rohita (rohu): 127168935 Help Entry 127168935         CDS       T09007                                  Symbol calml4a Name (RefSeq) calmodulin-like protein 4a   KO K02183   calmodulin Organism lroh  Labeo rohita (rohu) Pathway lroh04020   Calcium signaling pathway lroh04070   Phosphatidylinositol signaling system lroh04114   Oocyte meiosis lroh04218   Cellular senescence lroh04261   Adrenergic signaling in cardiomyocytes lroh04270   Vascular smooth muscle contraction lroh04371   Apelin signaling pathway lroh04625   C-type lectin receptor signaling pathway lroh04744   Phototransduction lroh04910   Insulin signaling pathway lroh04912   GnRH signaling pathway lroh04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lroh00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     127168935 (calml4a)    04020 Calcium signaling pathway     127168935 (calml4a)    04070 Phosphatidylinositol signaling system     127168935 (calml4a)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     127168935 (calml4a)    04218 Cellular senescence     127168935 (calml4a)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127168935 (calml4a)   09152 Endocrine system    04910 Insulin signaling pathway     127168935 (calml4a)    04912 GnRH signaling pathway     127168935 (calml4a)    04916 Melanogenesis     127168935 (calml4a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     127168935 (calml4a)    04270 Vascular smooth muscle contraction     127168935 (calml4a)   09157 Sensory system    04744 Phototransduction     127168935 (calml4a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lroh01009]     127168935 (calml4a)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lroh04131]     127168935 (calml4a)    03036 Chromosome and associated proteins [BR:lroh03036]     127168935 (calml4a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127168935 (calml4a) Protein phosphatases and associated proteins [BR:lroh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      127168935 (calml4a) Membrane trafficking [BR:lroh04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     127168935 (calml4a) Chromosome and associated proteins [BR:lroh03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      127168935 (calml4a) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    127168935 (calml4a) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_8 CFAP251_C AIF-1 EF-hand_5 FlgD GPHH Motif Other DBs NCBI-GeneID:  127168935 NCBI-ProteinID:  XP_050972044 LinkDB All DBs Position 7:complement(28747314..28748787) Genome browser AA seq 153 aa AA seqDB search MAKFLTQNQIDEFKECFSLYDKKRKGKIEAKDLITVMRCLGTSPTYNEVDRHLQIHKIEK TGELDFSTFLTMMHRQMQQEDPKAEILEAMRMTDKHKKGYILASELRAKLTGLGEKLTDK EVDELFREANVGRDGHVYYEEFTRMVTLPTIDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcaaaatttttaacgcaaaatcaaattgatgagttcaaagaatgtttctcgctttac gacaagaagcgaaaggggaagattgaagccaaagacctcattacagtcatgcgatgtctg ggtacaagtcccacatataatgaagtggacagacatctgcaaatccacaaaatagaaaag acaggggagttggatttttctacatttctaaccatgatgcatagacagatgcagcaggaa gatcctaaggctgaaattctggaggctatgcgcatgacggacaaacacaagaagggctac attctggcctcagagctacgagccaaactcacaggcttgggagaaaagctcactgataaa gaagtggatgagctttttagagaggctaatgttgggcgtgatggacatgtttattatgag gagttcaccagaatggtcacgcttcctacaattgactactga

DBGET integrated database retrieval system