Labeo rohita (rohu): 127169619 Help Entry 127169619         CDS       T09007                                  Symbol rab7b Name (RefSeq) ras-related protein Rab-7b   KO K07897   Ras-related protein Rab-7A Organism lroh  Labeo rohita (rohu) Pathway lroh04137   Mitophagy - animal lroh04140   Autophagy - animal lroh04144   Endocytosis lroh04145   Phagosome lroh04148   Efferocytosis lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127169619 (rab7b)    04145 Phagosome     127169619 (rab7b)    04140 Autophagy - animal     127169619 (rab7b)    04137 Mitophagy - animal     127169619 (rab7b)    04148 Efferocytosis     127169619 (rab7b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127169619 (rab7b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lroh04131]     127169619 (rab7b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127169619 (rab7b)    04031 GTP-binding proteins [BR:lroh04031]     127169619 (rab7b) Membrane trafficking [BR:lroh04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     127169619 (rab7b) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127169619 (rab7b)   Exosomal proteins of other body fluids (saliva and urine)    127169619 (rab7b)   Exosomal proteins of colorectal cancer cells    127169619 (rab7b)   Exosomal proteins of bladder cancer cells    127169619 (rab7b) GTP-binding proteins [BR:lroh04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     127169619 (rab7b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 PduV-EutP Septin nSTAND3 AAA_7 AAA_16 AAA_22 NTPase_1 AAA_24 G-alpha ATPase_2 SRPRB AAA_5 ABC_tran ATP-synt_ab AAA_14 NACHT MCM Motif Other DBs NCBI-GeneID:  127169619 NCBI-ProteinID:  XP_050973084 LinkDB All DBs Position 8:5286248..5301760 Genome browser AA seq 204 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQETVD TYDFPDQIKLRDDRPVSSSDGCNC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgtaagaaggtgctgctcaaagtgatcatcctaggggattctggagttgga aagacctctttgatgaaccagtatgtcaataataagttcagtaaccagtataaggccaca attggagccgactttctgactaaggaggtgatggtggacgacagactggtcaccatgcag atatgggatacggcgggtcaggagcgctttcagtctctgggcgtggctttctacagaggg gcagactgttgcgtgctggtgtacgatgttacggcgccaactacattcaagactctggac agctggagggacgagtttcttattcaggccagtccacgcgacccggagaacttccccttt gttgtgctgggcaacaaaatcgacttggagaaccggcaggtaacgacaaagcgagctcaa gcgtggtgccagagtaagaacaacatcccctacttcgagaccagtgccaaagaagccatt aacgtggaccaggccttccaaaccatcgctcgcaatgcacttaaacaggagacggtggat acgtatgatttccccgaccagattaaactaagagacgacagacctgtgtccagcagtgat ggctgcaactgctga

DBGET integrated database retrieval system