Labeo rohita (rohu): 127169998 Help Entry 127169998         CDS       T09007                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism lroh  Labeo rohita (rohu) Pathway lroh04010   MAPK signaling pathway lroh04012   ErbB signaling pathway lroh04068   FoxO signaling pathway lroh04137   Mitophagy - animal lroh04140   Autophagy - animal lroh04150   mTOR signaling pathway lroh04210   Apoptosis lroh04218   Cellular senescence lroh04370   VEGF signaling pathway lroh04371   Apelin signaling pathway lroh04540   Gap junction lroh04625   C-type lectin receptor signaling pathway lroh04810   Regulation of actin cytoskeleton lroh04910   Insulin signaling pathway lroh04912   GnRH signaling pathway lroh04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lroh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127169998 (nras)    04012 ErbB signaling pathway     127169998 (nras)    04370 VEGF signaling pathway     127169998 (nras)    04371 Apelin signaling pathway     127169998 (nras)    04068 FoxO signaling pathway     127169998 (nras)    04150 mTOR signaling pathway     127169998 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127169998 (nras)    04137 Mitophagy - animal     127169998 (nras)   09143 Cell growth and death    04210 Apoptosis     127169998 (nras)    04218 Cellular senescence     127169998 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     127169998 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     127169998 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127169998 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     127169998 (nras)    04912 GnRH signaling pathway     127169998 (nras)    04916 Melanogenesis     127169998 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lroh04131]     127169998 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127169998 (nras)    04031 GTP-binding proteins [BR:lroh04031]     127169998 (nras) Membrane trafficking [BR:lroh04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127169998 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     127169998 (nras) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127169998 (nras)   Exosomal proteins of other body fluids (saliva and urine)    127169998 (nras)   Exosomal proteins of breast cancer cells    127169998 (nras)   Exosomal proteins of colorectal cancer cells    127169998 (nras) GTP-binding proteins [BR:lroh04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127169998 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  127169998 NCBI-ProteinID:  XP_050973675 LinkDB All DBs Position 8:29034880..29046154 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagttggttgttgtgggagcaggtggtgttgggaagagtgctttaact atccagctcattcagaatcactttgtggatgaatatgaccctactattgaggactcttac aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggt caggaagagtacagcgcaatgagggaccaatacatgaggacaggagagggtttcctctgt gtcttcgccataaacaacagcaaatccttcgccgatgtgcatttgtacagagaacagatc aagcgcgtgaaggactcggatgatgttccaatggtcctagtggggaacaagtgtgatttg gccagaacagtggacaccaagcaagctcaggaacttgccagaagctacggtatagagttt gtagaaacttctgccaagaccagacagggagtcgaggacgctttttacaccctcgtccgt gagatccgacattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system