Labeo rohita (rohu): 127178154 Help Entry 127178154         CDS       T09007                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism lroh  Labeo rohita (rohu) Pathway lroh04010   MAPK signaling pathway lroh04144   Endocytosis lroh04370   VEGF signaling pathway lroh04510   Focal adhesion lroh04520   Adherens junction lroh04530   Tight junction lroh04810   Regulation of actin cytoskeleton lroh04912   GnRH signaling pathway lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127178154 (cdc42l)    04370 VEGF signaling pathway     127178154 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127178154 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     127178154 (cdc42l)    04520 Adherens junction     127178154 (cdc42l)    04530 Tight junction     127178154 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     127178154 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     127178154 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127178154 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lroh04131]     127178154 (cdc42l)    03036 Chromosome and associated proteins [BR:lroh03036]     127178154 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127178154 (cdc42l)    04031 GTP-binding proteins [BR:lroh04031]     127178154 (cdc42l) Membrane trafficking [BR:lroh04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127178154 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     127178154 (cdc42l)   Macropinocytosis    Ras GTPases     127178154 (cdc42l) Chromosome and associated proteins [BR:lroh03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     127178154 (cdc42l) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of microglial cells    127178154 (cdc42l)   Exosomal proteins of breast milk    127178154 (cdc42l) GTP-binding proteins [BR:lroh04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127178154 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  127178154 NCBI-ProteinID:  XP_050986804 LinkDB All DBs Position 16:14626891..14635105 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDNNTVEKLAKNKQRPISPESGEKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggagatggagctgtcggaaagacctgccttctc atctcatacacaaccaacaaattcccctctgaatatgttcccacggtttttgataactat gctgtcacagtgatgattggaggcgaaccgtatacactgggactttttgacacagcaggt caggaagactacgacagacttcgacctctcagttatccgcagacagacgtcttccttgtt tgcttctcggttgtttctccttcctcctttgagaatgtgaaagagaagtgggtaccagag atctctcaccactgtccacgcactccattccttctggtgggcactcaggtcgacctgagg gatgacaataacactgtggaaaaacttgccaaaaataagcagcgccccatatcgcccgag agtggggagaagctggccagagacctcagagctgtcaaatacgtggagtgctccgccctc acacagagaggcctgaagaatgttttcgacgaggcgatacttgctgcccttgaacctccg gagaccaaacccaagaagcgctgcgtccttttgtag

DBGET integrated database retrieval system