Labeo rohita (rohu): 127178414 Help Entry 127178414         CDS       T09007                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism lroh  Labeo rohita (rohu) Pathway lroh04382   Cornified envelope formation lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     127178414 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127178414 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127178414 (s100a10b) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of microglial cells    127178414 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_6 Motif Other DBs NCBI-GeneID:  127178414 NCBI-ProteinID:  XP_050987232 LinkDB All DBs Position 16:complement(20193949..20195398) Genome browser AA seq 102 aa AA seqDB search MPSDLERAMEMLITVFHRYASKEGGSASLNRRELKMLMEAELGTFLKSQKDPATVDRIMR DLDSNGDGEVNFEEFVSLVVGLSIACEQIYRLHMQSKGVKKQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagcgatggagatgctgatcacagtgtttcaccgttatgcg agcaaagaaggtggaagtgcatcattaaatcgcagggagctcaaaatgctgatggaggca gagttgggcacctttctgaagtctcagaaggaccctgctaccgtagacaggattatgagg gatttggatagtaatggtgatggagaagtgaattttgaagagtttgtgtctcttgtggtg ggcctgtccattgcctgcgaacaaatataccggttacacatgcagtcaaagggtgtcaaa aagcagtaa

DBGET integrated database retrieval system