Labeo rohita (rohu): 127180140 Help Entry 127180140         CDS       T09007                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism lroh  Labeo rohita (rohu) Pathway lroh04814   Motor proteins lroh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lroh00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     127180140  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127180140  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lroh03037]     127180140    04812 Cytoskeleton proteins [BR:lroh04812]     127180140 Cilium and associated proteins [BR:lroh03037]  Motile cilia and associated proteins   Dynein arm    127180140 Cytoskeleton proteins [BR:lroh04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127180140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 TM1586_NiRdase Motif Other DBs NCBI-GeneID:  127180140 NCBI-ProteinID:  XP_050990064 LinkDB All DBs Position 17:complement(15583415..15584483) Genome browser AA seq 113 aa AA seqDB search MDEDQASEETTFVVDEITTVIKETVESTIGNSSYQHSKVNQWTSSIVESSLNQLTKLGKP FKYIVTCIILQKNGAGLHTASSCFWDNSTDGSCTVRWENKTIYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgaggatcaggcttctgaggagactacatttgttgtggacgagattaccacagtt atcaaagaaactgttgaaagcaccattggaaacagctcttaccaacacagtaaagtcaac cagtggacatcaagcattgtagaatcaagtctaaaccagctaactaaattaggaaaacct ttcaagtacatcgtgacatgcatcatactacaaaaaaatggggcaggtttgcacactgcc agctcgtgtttctgggacaacagtacagatggcagctgcacggtacgatgggaaaataaa accatatactgcatagttagtgtttttgggctggccatttga

DBGET integrated database retrieval system