Labeo rohita (rohu): 127181148 Help Entry 127181148         CDS       T09007                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism lroh  Labeo rohita (rohu) Brite KEGG Orthology (KO) [BR:lroh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lroh03019]     127181148 (mt2)    03029 Mitochondrial biogenesis [BR:lroh03029]     127181148 (mt2) Messenger RNA biogenesis [BR:lroh03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      127181148 (mt2) Mitochondrial biogenesis [BR:lroh03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     127181148 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  127181148 NCBI-ProteinID:  XP_050991654 LinkDB All DBs Position 18:11124292..11125160 Genome browser AA seq 60 aa AA seqDB search MDPCDCSKTGTCSCGATCKCTNCQCTTCKKSCCPCCPSGCSKCASGCVCKGNSCGSSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgtgattgctccaagactggaacttgtagctgtggtgccacctgcaagtgc actaattgccagtgtacaacctgcaagaagagctgctgtccctgctgcccatcaggctgc agcaagtgcgcctccggctgcgtgtgtaagggcaattcctgcggctccagctgctgtcaa tga

DBGET integrated database retrieval system