Lynx rufus (bobcat): 124503169 Help Entry 124503169         CDS       T08475                                  Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism lruf  Lynx rufus (bobcat) Pathway lruf01521   EGFR tyrosine kinase inhibitor resistance lruf01524   Platinum drug resistance lruf04014   Ras signaling pathway lruf04064   NF-kappa B signaling pathway lruf04115   p53 signaling pathway lruf04137   Mitophagy - animal lruf04140   Autophagy - animal lruf04151   PI3K-Akt signaling pathway lruf04210   Apoptosis lruf04215   Apoptosis - multiple species lruf04621   NOD-like receptor signaling pathway lruf04630   JAK-STAT signaling pathway lruf05012   Parkinson disease lruf05014   Amyotrophic lateral sclerosis lruf05022   Pathways of neurodegeneration - multiple diseases lruf05145   Toxoplasmosis lruf05162   Measles lruf05166   Human T-cell leukemia virus 1 infection lruf05168   Herpes simplex virus 1 infection lruf05170   Human immunodeficiency virus 1 infection lruf05200   Pathways in cancer lruf05202   Transcriptional misregulation in cancer lruf05212   Pancreatic cancer lruf05220   Chronic myeloid leukemia lruf05222   Small cell lung cancer lruf05225   Hepatocellular carcinoma lruf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     124503169    04630 JAK-STAT signaling pathway     124503169    04064 NF-kappa B signaling pathway     124503169    04151 PI3K-Akt signaling pathway     124503169  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124503169    04137 Mitophagy - animal     124503169   09143 Cell growth and death    04210 Apoptosis     124503169    04215 Apoptosis - multiple species     124503169    04115 p53 signaling pathway     124503169  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     124503169  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124503169    05202 Transcriptional misregulation in cancer     124503169   09162 Cancer: specific types    05212 Pancreatic cancer     124503169    05225 Hepatocellular carcinoma     124503169    05220 Chronic myeloid leukemia     124503169    05222 Small cell lung cancer     124503169   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124503169    05170 Human immunodeficiency virus 1 infection     124503169    05162 Measles     124503169    05168 Herpes simplex virus 1 infection     124503169   09174 Infectious disease: parasitic    05145 Toxoplasmosis     124503169   09164 Neurodegenerative disease    05012 Parkinson disease     124503169    05014 Amyotrophic lateral sclerosis     124503169    05022 Pathways of neurodegeneration - multiple diseases     124503169   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124503169   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     124503169    01524 Platinum drug resistance     124503169  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lruf01009]     124503169   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lruf03036]     124503169   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:lruf02000]     124503169 Protein phosphatases and associated proteins [BR:lruf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      124503169 Chromosome and associated proteins [BR:lruf03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     124503169 Transporters [BR:lruf02000]  Other transporters   Pores ion channels [TC:1]    124503169 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  124503169 NCBI-ProteinID:  XP_046923994 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system