Lynx rufus (bobcat): 124503245 Help Entry 124503245         CDS       T08475                                  Name (RefSeq) profilin-4   KO K05759   profilin Organism lruf  Lynx rufus (bobcat) Pathway lruf04015   Rap1 signaling pathway lruf04810   Regulation of actin cytoskeleton lruf05014   Amyotrophic lateral sclerosis lruf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     124503245  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     124503245  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124503245   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     124503245  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lruf04131]     124503245   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lruf04812]     124503245    04147 Exosome [BR:lruf04147]     124503245 Membrane trafficking [BR:lruf04131]  Others   Actin-binding proteins    Others     124503245 Cytoskeleton proteins [BR:lruf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      124503245 Exosome [BR:lruf04147]  Exosomal proteins   Proteins found in most exosomes    124503245 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  124503245 NCBI-ProteinID:  XP_046924095 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcggccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system