Lynx rufus (bobcat): 124504103 Help Entry 124504103         CDS       T08475                                  Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism lruf  Lynx rufus (bobcat) Pathway lruf04010   MAPK signaling pathway lruf04020   Calcium signaling pathway lruf04022   cGMP-PKG signaling pathway lruf04114   Oocyte meiosis lruf04218   Cellular senescence lruf04310   Wnt signaling pathway lruf04360   Axon guidance lruf04370   VEGF signaling pathway lruf04380   Osteoclast differentiation lruf04625   C-type lectin receptor signaling pathway lruf04650   Natural killer cell mediated cytotoxicity lruf04658   Th1 and Th2 cell differentiation lruf04659   Th17 cell differentiation lruf04660   T cell receptor signaling pathway lruf04662   B cell receptor signaling pathway lruf04720   Long-term potentiation lruf04724   Glutamatergic synapse lruf04921   Oxytocin signaling pathway lruf04922   Glucagon signaling pathway lruf04924   Renin secretion lruf05010   Alzheimer disease lruf05014   Amyotrophic lateral sclerosis lruf05020   Prion disease lruf05022   Pathways of neurodegeneration - multiple diseases lruf05031   Amphetamine addiction lruf05152   Tuberculosis lruf05163   Human cytomegalovirus infection lruf05166   Human T-cell leukemia virus 1 infection lruf05167   Kaposi sarcoma-associated herpesvirus infection lruf05170   Human immunodeficiency virus 1 infection lruf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lruf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124504103    04310 Wnt signaling pathway     124504103    04370 VEGF signaling pathway     124504103    04020 Calcium signaling pathway     124504103    04022 cGMP-PKG signaling pathway     124504103  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     124504103    04218 Cellular senescence     124504103  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124504103    04650 Natural killer cell mediated cytotoxicity     124504103    04660 T cell receptor signaling pathway     124504103    04658 Th1 and Th2 cell differentiation     124504103    04659 Th17 cell differentiation     124504103    04662 B cell receptor signaling pathway     124504103   09152 Endocrine system    04922 Glucagon signaling pathway     124504103    04921 Oxytocin signaling pathway     124504103    04924 Renin secretion     124504103   09156 Nervous system    04724 Glutamatergic synapse     124504103    04720 Long-term potentiation     124504103   09158 Development and regeneration    04360 Axon guidance     124504103    04380 Osteoclast differentiation     124504103  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124504103   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124504103    05170 Human immunodeficiency virus 1 infection     124504103    05163 Human cytomegalovirus infection     124504103    05167 Kaposi sarcoma-associated herpesvirus infection     124504103   09171 Infectious disease: bacterial    05152 Tuberculosis     124504103   09164 Neurodegenerative disease    05010 Alzheimer disease     124504103    05014 Amyotrophic lateral sclerosis     124504103    05020 Prion disease     124504103    05022 Pathways of neurodegeneration - multiple diseases     124504103   09165 Substance dependence    05031 Amphetamine addiction     124504103   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124504103  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lruf01009]     124504103 Protein phosphatases and associated proteins [BR:lruf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      124504103 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  124504103 NCBI-ProteinID:  XP_046925379 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat atatttgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagatggctatatttccaacggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system