Lynx rufus (bobcat): 124504111 Help Entry 124504111         CDS       T08475                                  Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism lruf  Lynx rufus (bobcat) Pathway lruf04140   Autophagy - animal lruf05014   Amyotrophic lateral sclerosis lruf05022   Pathways of neurodegeneration - multiple diseases lruf05134   Legionellosis Brite KEGG Orthology (KO) [BR:lruf00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124504111  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     124504111   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     124504111    05022 Pathways of neurodegeneration - multiple diseases     124504111  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lruf04131]     124504111   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124504111    04031 GTP-binding proteins [BR:lruf04031]     124504111 Membrane trafficking [BR:lruf04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     124504111  Autophagy   Other autophagy associated proteins     124504111 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124504111   Exosomal proteins of other body fluids (saliva and urine)    124504111   Exosomal proteins of colorectal cancer cells    124504111 GTP-binding proteins [BR:lruf04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     124504111 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_29 LANC_like AAA_16 AAA_22 Septin AAA_5 Dioxygenase_N CRAL_TRIO_2 TniB Motif Other DBs NCBI-GeneID:  124504111 NCBI-ProteinID:  XP_046925392 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgcctcctccttaggtttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aagcttcaaatatgggacacagcaggccaagaaagattccgaacaatcacctccagttat tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aatgttaaacagtggctgcaggaaatagaccgttatgccagtgaaaacgtcaacaagttg ttggtagggaacaaatgcgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgcagattcccttggaattccatttttggaaaccagtgctaagaatgcaacgaat gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca acagctggtggtgcagagaagtccaatgttaaaattcagagcactccggtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system