Lynx rufus (bobcat): 124504739 Help Entry 124504739         CDS       T08475                                  Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism lruf  Lynx rufus (bobcat) Pathway lruf04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:lruf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     124504739  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:lruf03016]     124504739    04121 Ubiquitin system [BR:lruf04121]     124504739 Transfer RNA biogenesis [BR:lruf03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     124504739 Ubiquitin system [BR:lruf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    124504739 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  124504739 NCBI-ProteinID:  XP_046926198 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MAAPLSVEVEFGGGAELLFDGIKKHQVTLPGQEEPWDIRNLLVWIKKNLLKERPELFIQG DSVRPGILVLVNDADWELLGELDYQLQDQDNILFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcagcgcccttgtcggtggaggtggagttcggaggcggcgcagagctcctgttcgac ggcataaagaagcatcaggtcaccttgcctggacaggaggaaccctgggacatccggaac ctccttgtctggatcaagaagaacttgctaaaagagcggccagagttgttcatccaggga gatagcgtgcggccaggaattctggtgctcgttaacgatgccgactgggaactgctgggt gagctggactaccagctgcaggaccaggacaacatcctcttcatatccacgctgcacggc ggctga

DBGET integrated database retrieval system