Lynx rufus (bobcat): 124505490 Help Entry 124505490         CDS       T08475                                  Name (RefSeq) cofilin-1   KO K05765   cofilin Organism lruf  Lynx rufus (bobcat) Pathway lruf04360   Axon guidance lruf04666   Fc gamma R-mediated phagocytosis lruf04810   Regulation of actin cytoskeleton lruf05133   Pertussis lruf05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:lruf00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     124505490  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     124505490   09158 Development and regeneration    04360 Axon guidance     124505490  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     124505490   09171 Infectious disease: bacterial    05133 Pertussis     124505490  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lruf04131]     124505490   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lruf04812]     124505490    04147 Exosome [BR:lruf04147]     124505490 Membrane trafficking [BR:lruf04131]  Others   Actin-binding proteins    Others     124505490 Cytoskeleton proteins [BR:lruf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      124505490 Exosome [BR:lruf04147]  Exosomal proteins   Proteins found in most exosomes    124505490 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  124505490 NCBI-ProteinID:  XP_046927410 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggcagtctctgatggtgtcatcaaagtgttcaatgacatgaaggtt cgtaagtcctcaacaccagaggaggtgaagaagcgcaagaaggcggtactcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggtgatgtg ggccagactgtagacgatccctacgccacctttgtcaagatgctgccagacaaggactgc cgctatgccctctatgatgccacctacgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgaatgtgcacccctcaagagcaaaatgatttatgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggccgagaaactggggggcagcgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system