Lynx rufus (bobcat): 124507140 Help Entry 124507140         CDS       T08475                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism lruf  Lynx rufus (bobcat) Brite KEGG Orthology (KO) [BR:lruf00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lruf03037]     124507140 Cilium and associated proteins [BR:lruf03037]  Primary cilia and associated proteins   BBSome    124507140 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  124507140 NCBI-ProteinID:  XP_046929390 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MAEVKSMFREVLPKQGQLSVEDITTMVLCKPKLLPLKSLTLEKLEKMQQAAQDTIRQQEM AEKEQQQITH NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcggaagtgaagtcaatgttccgggaagttcttccaaaacaagggcagctgtctgtg gaagatataaccacaatggtgctgtgtaaacccaaacttttacccttaaaatctctgact ttggaaaaattggagaaaatgcagcaagcagcccaggatacaattcgccaacaagaaatg gcagaaaaggaacaacagcaaataactcactga

DBGET integrated database retrieval system