Lynx rufus (bobcat): 124508912 Help Entry 124508912         CDS       T08475                                  Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism lruf  Lynx rufus (bobcat) Pathway lruf04024   cAMP signaling pathway lruf04062   Chemokine signaling pathway lruf04064   NF-kappa B signaling pathway lruf04210   Apoptosis lruf04380   Osteoclast differentiation lruf04620   Toll-like receptor signaling pathway lruf04621   NOD-like receptor signaling pathway lruf04622   RIG-I-like receptor signaling pathway lruf04623   Cytosolic DNA-sensing pathway lruf04625   C-type lectin receptor signaling pathway lruf04657   IL-17 signaling pathway lruf04658   Th1 and Th2 cell differentiation lruf04659   Th17 cell differentiation lruf04660   T cell receptor signaling pathway lruf04662   B cell receptor signaling pathway lruf04668   TNF signaling pathway lruf04722   Neurotrophin signaling pathway lruf04920   Adipocytokine signaling pathway lruf04926   Relaxin signaling pathway lruf04931   Insulin resistance lruf04936   Alcoholic liver disease lruf05132   Salmonella infection lruf05134   Legionellosis lruf05135   Yersinia infection lruf05140   Leishmaniasis lruf05142   Chagas disease lruf05145   Toxoplasmosis lruf05160   Hepatitis C lruf05161   Hepatitis B lruf05162   Measles lruf05163   Human cytomegalovirus infection lruf05164   Influenza A lruf05166   Human T-cell leukemia virus 1 infection lruf05167   Kaposi sarcoma-associated herpesvirus infection lruf05168   Herpes simplex virus 1 infection lruf05169   Epstein-Barr virus infection lruf05170   Human immunodeficiency virus 1 infection lruf05171   Coronavirus disease - COVID-19 lruf05200   Pathways in cancer lruf05203   Viral carcinogenesis lruf05208   Chemical carcinogenesis - reactive oxygen species lruf05215   Prostate cancer lruf05220   Chronic myeloid leukemia lruf05222   Small cell lung cancer lruf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lruf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     124508912    04668 TNF signaling pathway     124508912    04024 cAMP signaling pathway     124508912  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     124508912  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124508912    04621 NOD-like receptor signaling pathway     124508912    04622 RIG-I-like receptor signaling pathway     124508912    04623 Cytosolic DNA-sensing pathway     124508912    04625 C-type lectin receptor signaling pathway     124508912    04660 T cell receptor signaling pathway     124508912    04658 Th1 and Th2 cell differentiation     124508912    04659 Th17 cell differentiation     124508912    04657 IL-17 signaling pathway     124508912    04662 B cell receptor signaling pathway     124508912    04062 Chemokine signaling pathway     124508912   09152 Endocrine system    04920 Adipocytokine signaling pathway     124508912    04926 Relaxin signaling pathway     124508912   09156 Nervous system    04722 Neurotrophin signaling pathway     124508912   09158 Development and regeneration    04380 Osteoclast differentiation     124508912  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124508912    05208 Chemical carcinogenesis - reactive oxygen species     124508912    05203 Viral carcinogenesis     124508912    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124508912   09162 Cancer: specific types    05220 Chronic myeloid leukemia     124508912    05215 Prostate cancer     124508912    05222 Small cell lung cancer     124508912   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124508912    05170 Human immunodeficiency virus 1 infection     124508912    05161 Hepatitis B     124508912    05160 Hepatitis C     124508912    05171 Coronavirus disease - COVID-19     124508912    05164 Influenza A     124508912    05162 Measles     124508912    05168 Herpes simplex virus 1 infection     124508912    05163 Human cytomegalovirus infection     124508912    05167 Kaposi sarcoma-associated herpesvirus infection     124508912    05169 Epstein-Barr virus infection     124508912   09171 Infectious disease: bacterial    05132 Salmonella infection     124508912    05135 Yersinia infection     124508912    05134 Legionellosis     124508912   09174 Infectious disease: parasitic    05145 Toxoplasmosis     124508912    05140 Leishmaniasis     124508912    05142 Chagas disease     124508912   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124508912   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     124508912    04931 Insulin resistance     124508912  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:lruf03000]     124508912    04131 Membrane trafficking [BR:lruf04131]     124508912 Transcription factors [BR:lruf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     124508912 Membrane trafficking [BR:lruf04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     124508912 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  124508912 NCBI-ProteinID:  XP_046931570 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGTEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaacccgccgagcacgcccaggactgggccatggagggtccccgggacgcgctc aagaaagagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaagagctgcgggagatccggcttgagccccaggaggcgccg cgcggcaccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcattgaccatggaagtagtccgccaagtgaaaggagac ctggccttcctcaatttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctactccatcttgcaggccaccaac tacaatggtcacacatgtctacacttagcctctatccatggctacctgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaactgcc ctccaccttgcagtggacctgcagaattccgacctcgtgtcgcttttgttgaagtgcggg gctgatgtcaacagagtcacctaccaaggctactccccataccagctcacctggggccgt ccaagtacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctacgacacagagtcagagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system