Lynx rufus (bobcat): 124509424 Help Entry 124509424         CDS       T08475                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism lruf  Lynx rufus (bobcat) Pathway lruf04060   Cytokine-cytokine receptor interaction lruf04151   PI3K-Akt signaling pathway lruf04210   Apoptosis lruf04630   JAK-STAT signaling pathway lruf04640   Hematopoietic cell lineage lruf04664   Fc epsilon RI signaling pathway lruf05200   Pathways in cancer lruf05202   Transcriptional misregulation in cancer lruf05221   Acute myeloid leukemia lruf05310   Asthma Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     124509424    04151 PI3K-Akt signaling pathway     124509424   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124509424  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     124509424  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     124509424    04664 Fc epsilon RI signaling pathway     124509424  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124509424    05202 Transcriptional misregulation in cancer     124509424   09162 Cancer: specific types    05221 Acute myeloid leukemia     124509424   09163 Immune disease    05310 Asthma     124509424  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lruf04052]     124509424    00536 Glycosaminoglycan binding proteins [BR:lruf00536]     124509424 Cytokines and neuropeptides [BR:lruf04052]  Cytokines   Interleukins    124509424 Glycosaminoglycan binding proteins [BR:lruf00536]  Heparan sulfate / Heparin   Cytokines    124509424 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL3 AtzG-like Motif Other DBs NCBI-GeneID:  124509424 NCBI-ProteinID:  XP_046931977 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MSNLPIMYLLLLLLGFQAPQAQGRPFLTYQLNQYLAKIDEIMQILNKLPLPSQDPLDPNE TEILRENTLLRPNLDAFLKAAENFHEDGLLIWKNLKEFLPLLPTPTPRGDPIHIEEDNWV DFQRKLTKYLEILDNFLNFKEKH NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccttcccatcatgtaccttctcctgcttcttcttggattccaagcccctcag gcacaggggcggccctttctgacataccagctgaaccaatacttggcaaagattgatgaa attatgcagatcttaaacaagttacccttgccttcacaggaccccttggacccaaatgag acagagatcctgagggaaaacacccttctgaggccaaacctggatgcattcttaaaagct gcagaaaatttccatgaagatggactgctaatctggaaaaatcttaaggaattcctgcca ctcctgcccactcccacacccaggggagacccaatccatatcgaggaggataactgggtt gatttccaaaggaaactgactaaatatctggaaatccttgataactttctgaatttcaag gagaaacactga

DBGET integrated database retrieval system