Lynx rufus (bobcat): 124509443 Help Entry 124509443         CDS       T08475                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism lruf  Lynx rufus (bobcat) Pathway lruf04814   Motor proteins lruf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lruf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     124509443  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124509443  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lruf03037]     124509443    04812 Cytoskeleton proteins [BR:lruf04812]     124509443 Cilium and associated proteins [BR:lruf03037]  Motile cilia and associated proteins   Dynein arm    124509443 Cytoskeleton proteins [BR:lruf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      124509443 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  124509443 NCBI-ProteinID:  XP_046932022 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNVDEAHNIVKECIDGVLGGEDYNQNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgttgatgaagctcacaat attgttaaagagtgtatagatggggtcttgggaggtgaagattataaccagaataacatc aaccaatggactgcaagcatcgtggaacagtccttaacacatttggttaagctgggaaaa gcttataaatatatcgtgacctgtgcggtggtccagaggagtgcatatggctttcacaca gccagttcatgtttttgggatactacatctgatggaacctgtaccgtgagatgggagaac cgaaccatgaactgtattgtcaatgtttttgccattgctattgtcctgtga

DBGET integrated database retrieval system