Lynx rufus (bobcat): 124513321 Help Entry 124513321         CDS       T08475                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism lruf  Lynx rufus (bobcat) Pathway lruf04060   Cytokine-cytokine receptor interaction lruf04061   Viral protein interaction with cytokine and cytokine receptor lruf04062   Chemokine signaling pathway lruf04621   NOD-like receptor signaling pathway lruf04657   IL-17 signaling pathway lruf04668   TNF signaling pathway lruf04933   AGE-RAGE signaling pathway in diabetic complications lruf05135   Yersinia infection lruf05142   Chagas disease lruf05144   Malaria lruf05163   Human cytomegalovirus infection lruf05164   Influenza A lruf05168   Herpes simplex virus 1 infection lruf05171   Coronavirus disease - COVID-19 lruf05323   Rheumatoid arthritis lruf05417   Lipid and atherosclerosis lruf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     124513321   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124513321    04061 Viral protein interaction with cytokine and cytokine receptor     124513321  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     124513321    04657 IL-17 signaling pathway     124513321    04062 Chemokine signaling pathway     124513321  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     124513321    05164 Influenza A     124513321    05168 Herpes simplex virus 1 infection     124513321    05163 Human cytomegalovirus infection     124513321   09171 Infectious disease: bacterial    05135 Yersinia infection     124513321   09174 Infectious disease: parasitic    05144 Malaria     124513321    05142 Chagas disease     124513321   09163 Immune disease    05323 Rheumatoid arthritis     124513321   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124513321    05418 Fluid shear stress and atherosclerosis     124513321   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     124513321  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lruf04052]     124513321    00536 Glycosaminoglycan binding proteins [BR:lruf00536]     124513321 Cytokines and neuropeptides [BR:lruf04052]  Cytokines   Chemokines    124513321 Glycosaminoglycan binding proteins [BR:lruf00536]  Heparan sulfate / Heparin   Chemokines    124513321 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  124513321 NCBI-ProteinID:  XP_046937150 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKVSAALLCLLLTAAAFSLQVLAQPDAINSPVTCCYTLTNKKISMQRLASYKRVTSSKCP KEAVIFKTILNKEICADPNQKWVKDSMAHLDKKTQTAKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag gtgctcgcccagccagatgcaattaattctccagtcacctgctgctatacactcaccaat aagaagatctcgatgcagaggctggcgagctataaaagagtcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaaccag aagtgggtcaaggattccatggcgcacctggacaagaagacccaaactgcaaagccttga

DBGET integrated database retrieval system