Lynx rufus (bobcat): 124513410 Help Entry 124513410         CDS       T08475                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism lruf  Lynx rufus (bobcat) Pathway lruf04613   Neutrophil extracellular trap formation lruf05034   Alcoholism lruf05202   Transcriptional misregulation in cancer lruf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lruf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124513410  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     124513410   09163 Immune disease    05322 Systemic lupus erythematosus     124513410   09165 Substance dependence    05034 Alcoholism     124513410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lruf03036]     124513410   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124513410 Chromosome and associated proteins [BR:lruf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124513410 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124513410 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  124513410 NCBI-ProteinID:  XP_046937338 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagacggctcgtaaatctacgggtgggaaagcgccccgtaagcag ctggccactaaagccgccaggaaaagtgctccctctactggcggggtgaaaaaacctcat cgctacaggcccgggaccgttgcgcttcgagagatccgtcgttaccagaaatcgaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgatctgaggtttcagagtgccgccattggtgcgctgcaggaggccagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system