Lynx rufus (bobcat): 124515571 Help Entry 124515571         CDS       T08475                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism lruf  Lynx rufus (bobcat) Pathway lruf04382   Cornified envelope formation lruf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lruf00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     124515571  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124515571  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124515571 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of microglial cells    124515571 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  124515571 NCBI-ProteinID:  XP_046940495 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaacgatgatgttcacattccacaagtttgct ggggacaaaggctacctaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggctgtggacaagataatgaaggacctagac cagtgccgggacggcagagtgggtttccagagcttcttttcgctgatcgctgggctcacc atcgcatgcaatgactattttgtagttcacatgaagcagaaaggaaagaagtag

DBGET integrated database retrieval system