Lynx rufus (bobcat): 124515937 Help Entry 124515937         CDS       T08475                                  Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism lruf  Lynx rufus (bobcat) Pathway lruf04022   cGMP-PKG signaling pathway lruf04081   Hormone signaling lruf04270   Vascular smooth muscle contraction lruf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     124515937   09133 Signaling molecules and interaction    04081 Hormone signaling     124515937  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     124515937  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     124515937  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lruf04052]     124515937 Cytokines and neuropeptides [BR:lruf04052]  Neuropeptides   Unclassified    124515937 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  124515937 NCBI-ProteinID:  XP_046940973 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tctgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccaggggaggagctg gccgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggtggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcggcgtgggcccgccttctgcacgagcaccctaacgcgcgcaaatacaaggga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system