KEGG   Lynx rufus (bobcat): 124516245
Entry
124516245         CDS       T08475                                 
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
lruf  Lynx rufus (bobcat)
Pathway
lruf01521  EGFR tyrosine kinase inhibitor resistance
lruf01522  Endocrine resistance
lruf04010  MAPK signaling pathway
lruf04012  ErbB signaling pathway
lruf04014  Ras signaling pathway
lruf04015  Rap1 signaling pathway
lruf04062  Chemokine signaling pathway
lruf04068  FoxO signaling pathway
lruf04071  Sphingolipid signaling pathway
lruf04072  Phospholipase D signaling pathway
lruf04137  Mitophagy - animal
lruf04140  Autophagy - animal
lruf04150  mTOR signaling pathway
lruf04151  PI3K-Akt signaling pathway
lruf04210  Apoptosis
lruf04211  Longevity regulating pathway
lruf04213  Longevity regulating pathway - multiple species
lruf04218  Cellular senescence
lruf04360  Axon guidance
lruf04370  VEGF signaling pathway
lruf04371  Apelin signaling pathway
lruf04540  Gap junction
lruf04550  Signaling pathways regulating pluripotency of stem cells
lruf04625  C-type lectin receptor signaling pathway
lruf04650  Natural killer cell mediated cytotoxicity
lruf04660  T cell receptor signaling pathway
lruf04662  B cell receptor signaling pathway
lruf04664  Fc epsilon RI signaling pathway
lruf04714  Thermogenesis
lruf04720  Long-term potentiation
lruf04722  Neurotrophin signaling pathway
lruf04725  Cholinergic synapse
lruf04726  Serotonergic synapse
lruf04730  Long-term depression
lruf04810  Regulation of actin cytoskeleton
lruf04910  Insulin signaling pathway
lruf04912  GnRH signaling pathway
lruf04915  Estrogen signaling pathway
lruf04916  Melanogenesis
lruf04917  Prolactin signaling pathway
lruf04919  Thyroid hormone signaling pathway
lruf04921  Oxytocin signaling pathway
lruf04926  Relaxin signaling pathway
lruf04929  GnRH secretion
lruf04933  AGE-RAGE signaling pathway in diabetic complications
lruf04935  Growth hormone synthesis, secretion and action
lruf05010  Alzheimer disease
lruf05022  Pathways of neurodegeneration - multiple diseases
lruf05034  Alcoholism
lruf05160  Hepatitis C
lruf05161  Hepatitis B
lruf05163  Human cytomegalovirus infection
lruf05165  Human papillomavirus infection
lruf05166  Human T-cell leukemia virus 1 infection
lruf05167  Kaposi sarcoma-associated herpesvirus infection
lruf05170  Human immunodeficiency virus 1 infection
lruf05200  Pathways in cancer
lruf05203  Viral carcinogenesis
lruf05205  Proteoglycans in cancer
lruf05206  MicroRNAs in cancer
lruf05207  Chemical carcinogenesis - receptor activation
lruf05208  Chemical carcinogenesis - reactive oxygen species
lruf05210  Colorectal cancer
lruf05211  Renal cell carcinoma
lruf05213  Endometrial cancer
lruf05214  Glioma
lruf05215  Prostate cancer
lruf05216  Thyroid cancer
lruf05218  Melanoma
lruf05219  Bladder cancer
lruf05220  Chronic myeloid leukemia
lruf05221  Acute myeloid leukemia
lruf05223  Non-small cell lung cancer
lruf05224  Breast cancer
lruf05225  Hepatocellular carcinoma
lruf05226  Gastric cancer
lruf05230  Central carbon metabolism in cancer
lruf05231  Choline metabolism in cancer
lruf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lruf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lruf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    124516245
   04012 ErbB signaling pathway
    124516245
   04014 Ras signaling pathway
    124516245
   04015 Rap1 signaling pathway
    124516245
   04370 VEGF signaling pathway
    124516245
   04371 Apelin signaling pathway
    124516245
   04068 FoxO signaling pathway
    124516245
   04072 Phospholipase D signaling pathway
    124516245
   04071 Sphingolipid signaling pathway
    124516245
   04151 PI3K-Akt signaling pathway
    124516245
   04150 mTOR signaling pathway
    124516245
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    124516245
   04137 Mitophagy - animal
    124516245
  09143 Cell growth and death
   04210 Apoptosis
    124516245
   04218 Cellular senescence
    124516245
  09144 Cellular community - eukaryotes
   04540 Gap junction
    124516245
   04550 Signaling pathways regulating pluripotency of stem cells
    124516245
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    124516245
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    124516245
   04650 Natural killer cell mediated cytotoxicity
    124516245
   04660 T cell receptor signaling pathway
    124516245
   04662 B cell receptor signaling pathway
    124516245
   04664 Fc epsilon RI signaling pathway
    124516245
   04062 Chemokine signaling pathway
    124516245
  09152 Endocrine system
   04910 Insulin signaling pathway
    124516245
   04929 GnRH secretion
    124516245
   04912 GnRH signaling pathway
    124516245
   04915 Estrogen signaling pathway
    124516245
   04917 Prolactin signaling pathway
    124516245
   04921 Oxytocin signaling pathway
    124516245
   04926 Relaxin signaling pathway
    124516245
   04935 Growth hormone synthesis, secretion and action
    124516245
   04919 Thyroid hormone signaling pathway
    124516245
   04916 Melanogenesis
    124516245
  09156 Nervous system
   04725 Cholinergic synapse
    124516245
   04726 Serotonergic synapse
    124516245
   04720 Long-term potentiation
    124516245
   04730 Long-term depression
    124516245
   04722 Neurotrophin signaling pathway
    124516245
  09158 Development and regeneration
   04360 Axon guidance
    124516245
  09149 Aging
   04211 Longevity regulating pathway
    124516245
   04213 Longevity regulating pathway - multiple species
    124516245
  09159 Environmental adaptation
   04714 Thermogenesis
    124516245
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    124516245
   05206 MicroRNAs in cancer
    124516245
   05205 Proteoglycans in cancer
    124516245
   05207 Chemical carcinogenesis - receptor activation
    124516245
   05208 Chemical carcinogenesis - reactive oxygen species
    124516245
   05203 Viral carcinogenesis
    124516245
   05230 Central carbon metabolism in cancer
    124516245
   05231 Choline metabolism in cancer
    124516245
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    124516245
  09162 Cancer: specific types
   05210 Colorectal cancer
    124516245
   05225 Hepatocellular carcinoma
    124516245
   05226 Gastric cancer
    124516245
   05214 Glioma
    124516245
   05216 Thyroid cancer
    124516245
   05221 Acute myeloid leukemia
    124516245
   05220 Chronic myeloid leukemia
    124516245
   05218 Melanoma
    124516245
   05211 Renal cell carcinoma
    124516245
   05219 Bladder cancer
    124516245
   05215 Prostate cancer
    124516245
   05213 Endometrial cancer
    124516245
   05224 Breast cancer
    124516245
   05223 Non-small cell lung cancer
    124516245
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    124516245
   05170 Human immunodeficiency virus 1 infection
    124516245
   05161 Hepatitis B
    124516245
   05160 Hepatitis C
    124516245
   05163 Human cytomegalovirus infection
    124516245
   05167 Kaposi sarcoma-associated herpesvirus infection
    124516245
   05165 Human papillomavirus infection
    124516245
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    124516245
   05022 Pathways of neurodegeneration - multiple diseases
    124516245
  09165 Substance dependence
   05034 Alcoholism
    124516245
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    124516245
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    124516245
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    124516245
   01522 Endocrine resistance
    124516245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lruf04131]
    124516245
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lruf04147]
    124516245
   04031 GTP-binding proteins [BR:lruf04031]
    124516245
Membrane trafficking [BR:lruf04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    124516245
 Endocytosis
  Macropinocytosis
   Ras GTPases
    124516245
Exosome [BR:lruf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   124516245
  Exosomal proteins of other body fluids (saliva and urine)
   124516245
  Exosomal proteins of breast cancer cells
   124516245
  Exosomal proteins of colorectal cancer cells
   124516245
GTP-binding proteins [BR:lruf04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    124516245
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 124516245
NCBI-ProteinID: XP_046941460
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctggt
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt
aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggaccgtcgacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system