KEGG   Lynx rufus (bobcat): 124519305
Entry
124519305         CDS       T08475                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
lruf  Lynx rufus (bobcat)
Pathway
lruf04010  MAPK signaling pathway
lruf04014  Ras signaling pathway
lruf04015  Rap1 signaling pathway
lruf04024  cAMP signaling pathway
lruf04062  Chemokine signaling pathway
lruf04071  Sphingolipid signaling pathway
lruf04145  Phagosome
lruf04148  Efferocytosis
lruf04151  PI3K-Akt signaling pathway
lruf04310  Wnt signaling pathway
lruf04360  Axon guidance
lruf04370  VEGF signaling pathway
lruf04380  Osteoclast differentiation
lruf04510  Focal adhesion
lruf04517  IgSF CAM signaling
lruf04518  Integrin signaling
lruf04520  Adherens junction
lruf04530  Tight junction
lruf04613  Neutrophil extracellular trap formation
lruf04620  Toll-like receptor signaling pathway
lruf04650  Natural killer cell mediated cytotoxicity
lruf04662  B cell receptor signaling pathway
lruf04664  Fc epsilon RI signaling pathway
lruf04666  Fc gamma R-mediated phagocytosis
lruf04670  Leukocyte transendothelial migration
lruf04722  Neurotrophin signaling pathway
lruf04810  Regulation of actin cytoskeleton
lruf04932  Non-alcoholic fatty liver disease
lruf04933  AGE-RAGE signaling pathway in diabetic complications
lruf04972  Pancreatic secretion
lruf05014  Amyotrophic lateral sclerosis
lruf05020  Prion disease
lruf05022  Pathways of neurodegeneration - multiple diseases
lruf05100  Bacterial invasion of epithelial cells
lruf05132  Salmonella infection
lruf05135  Yersinia infection
lruf05163  Human cytomegalovirus infection
lruf05167  Kaposi sarcoma-associated herpesvirus infection
lruf05169  Epstein-Barr virus infection
lruf05170  Human immunodeficiency virus 1 infection
lruf05200  Pathways in cancer
lruf05203  Viral carcinogenesis
lruf05205  Proteoglycans in cancer
lruf05208  Chemical carcinogenesis - reactive oxygen species
lruf05210  Colorectal cancer
lruf05211  Renal cell carcinoma
lruf05212  Pancreatic cancer
lruf05231  Choline metabolism in cancer
lruf05415  Diabetic cardiomyopathy
lruf05416  Viral myocarditis
lruf05417  Lipid and atherosclerosis
lruf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lruf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    124519305
   04014 Ras signaling pathway
    124519305
   04015 Rap1 signaling pathway
    124519305
   04310 Wnt signaling pathway
    124519305
   04370 VEGF signaling pathway
    124519305
   04071 Sphingolipid signaling pathway
    124519305
   04024 cAMP signaling pathway
    124519305
   04151 PI3K-Akt signaling pathway
    124519305
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    124519305
   04518 Integrin signaling
    124519305
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    124519305
   04148 Efferocytosis
    124519305
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    124519305
   04520 Adherens junction
    124519305
   04530 Tight junction
    124519305
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    124519305
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    124519305
   04620 Toll-like receptor signaling pathway
    124519305
   04650 Natural killer cell mediated cytotoxicity
    124519305
   04662 B cell receptor signaling pathway
    124519305
   04664 Fc epsilon RI signaling pathway
    124519305
   04666 Fc gamma R-mediated phagocytosis
    124519305
   04670 Leukocyte transendothelial migration
    124519305
   04062 Chemokine signaling pathway
    124519305
  09154 Digestive system
   04972 Pancreatic secretion
    124519305
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    124519305
  09158 Development and regeneration
   04360 Axon guidance
    124519305
   04380 Osteoclast differentiation
    124519305
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    124519305
   05205 Proteoglycans in cancer
    124519305
   05208 Chemical carcinogenesis - reactive oxygen species
    124519305
   05203 Viral carcinogenesis
    124519305
   05231 Choline metabolism in cancer
    124519305
  09162 Cancer: specific types
   05210 Colorectal cancer
    124519305
   05212 Pancreatic cancer
    124519305
   05211 Renal cell carcinoma
    124519305
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    124519305
   05163 Human cytomegalovirus infection
    124519305
   05167 Kaposi sarcoma-associated herpesvirus infection
    124519305
   05169 Epstein-Barr virus infection
    124519305
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    124519305
   05135 Yersinia infection
    124519305
   05100 Bacterial invasion of epithelial cells
    124519305
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    124519305
   05020 Prion disease
    124519305
   05022 Pathways of neurodegeneration - multiple diseases
    124519305
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    124519305
   05418 Fluid shear stress and atherosclerosis
    124519305
   05415 Diabetic cardiomyopathy
    124519305
   05416 Viral myocarditis
    124519305
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    124519305
   04933 AGE-RAGE signaling pathway in diabetic complications
    124519305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lruf04131]
    124519305
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lruf04147]
    124519305
   04031 GTP-binding proteins [BR:lruf04031]
    124519305
Membrane trafficking [BR:lruf04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    124519305
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    124519305
  Macropinocytosis
   Ras GTPases
    124519305
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    124519305
Exosome [BR:lruf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   124519305
  Exosomal proteins of other body fluids (saliva and urine)
   124519305
  Exosomal proteins of colorectal cancer cells
   124519305
  Exosomal proteins of bladder cancer cells
   124519305
GTP-binding proteins [BR:lruf04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    124519305
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 124519305
NCBI-ProteinID: XP_046945416
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagccgtaggtaaaacgtgcctactg
atcagttacacaaccaatgcgtttcctggagaatatatccccactgtctttgacaactac
tctgccaatgttatggtggatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgtcccttatcctatccgcaaacagatgtattcttaatt
tgcttttctcttgtgagtcctgcgtcatttgaaaatgttcgagcaaagtggtaccctgaa
gtgcgacaccactgtcccaacacccccatcatcttggtgggaactaaacttgacctcagg
gacgacaaagacacgattgagaaactgaaggagaaaaagctgactcccattacctacccg
cagggtttggccatggcgaaggagatcggtgctgtaaaatacctggagtgctcggcgctc
acgcagcgaggcctcaagacagtgtttgatgaagctattcgagcggttctctgcccccct
cccgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system