Lynx rufus (bobcat): 124519718 Help Entry 124519718         CDS       T08475                                  Name (RefSeq) profilin-1   KO K05759   profilin Organism lruf  Lynx rufus (bobcat) Pathway lruf04015   Rap1 signaling pathway lruf04810   Regulation of actin cytoskeleton lruf05014   Amyotrophic lateral sclerosis lruf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     124519718  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     124519718  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124519718   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     124519718  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lruf04131]     124519718   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lruf04812]     124519718    04147 Exosome [BR:lruf04147]     124519718 Membrane trafficking [BR:lruf04131]  Others   Actin-binding proteins    Others     124519718 Cytoskeleton proteins [BR:lruf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      124519718 Exosome [BR:lruf04147]  Exosomal proteins   Proteins found in most exosomes    124519718 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  124519718 NCBI-ProteinID:  XP_046946111 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaacgggctgacacttgggggccagaaatgctctgttatccgggactcgctgctgcag gacggggaatttaccatggatctccgtaccaagagcaccggcggagctcccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcgggatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system