Lynx rufus (bobcat): 124523720 Help Entry 124523720         CDS       T08475                                  Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism lruf  Lynx rufus (bobcat) Pathway lruf04060   Cytokine-cytokine receptor interaction lruf04630   JAK-STAT signaling pathway lruf04640   Hematopoietic cell lineage lruf04657   IL-17 signaling pathway lruf04658   Th1 and Th2 cell differentiation lruf04660   T cell receptor signaling pathway lruf04664   Fc epsilon RI signaling pathway lruf04672   Intestinal immune network for IgA production lruf05200   Pathways in cancer lruf05310   Asthma lruf05320   Autoimmune thyroid disease lruf05321   Inflammatory bowel disease lruf05330   Allograft rejection Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     124523720   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124523720  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     124523720    04660 T cell receptor signaling pathway     124523720    04658 Th1 and Th2 cell differentiation     124523720    04657 IL-17 signaling pathway     124523720    04664 Fc epsilon RI signaling pathway     124523720    04672 Intestinal immune network for IgA production     124523720  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124523720   09163 Immune disease    05310 Asthma     124523720    05320 Autoimmune thyroid disease     124523720    05321 Inflammatory bowel disease     124523720    05330 Allograft rejection     124523720  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lruf04052]     124523720    00536 Glycosaminoglycan binding proteins [BR:lruf00536]     124523720 Cytokines and neuropeptides [BR:lruf04052]  Cytokines   Interleukins    124523720 Glycosaminoglycan binding proteins [BR:lruf00536]  Heparan sulfate / Heparin   Cytokines    124523720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  124523720 NCBI-ProteinID:  XP_046951551 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH QLCIEEVFQGIDTLKNRTVPGDAVEKLFRNLSLIKEHIDRQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac caactgtgcattgaagaagtctttcagggtatagacacattaaagaatcgcactgtaccg ggggatgctgtggaaaagcttttccgaaacttgtctttaataaaagaacacatagaccgc caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacttgcaa gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system